![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
![]() | Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
![]() | Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [89091] (6 PDB entries) |
![]() | Domain d3pvwa1: 3pvw A:29-185 [239628] Other proteins in same PDB: d3pvwa2, d3pvwa3, d3pvwb_, d3pvwg_ automated match to d1omwa1 complexed with qrx |
PDB Entry: 3pvw (more details), 2.49 Å
SCOPe Domain Sequences for d3pvwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvwa1 a.91.1.1 (A:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih
Timeline for d3pvwa1: