SCOPe 2.08: Domain d3pvua1: 3pvu A:30-185

Lineage for d3pvua1 (3pvu A:30-185)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [89091] (6 PDB entries)

8. Domain d3pvua1: 3pvu A:30-185 [239625]
   Other proteins in same PDB: d3pvua2, d3pvua3, d3pvub_, d3pvug_
   automated match to d1omwa1
   complexed with qrw

Details for d3pvua1

PDB Entry: 3pvu, 2.48 Å

PDB Description: Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD101)

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3pvua1:

Sequence; same for both SEQRES and ATOM records:

>d3pvua1 a.91.1.1 (A:30-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyeei
kkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Timeline for d3pvua1:

• d3pvua1 first appeared in SCOPe 2.04
  
• d3pvua1 appears in SCOPe 2.07