Lineage for d3pefe2 (3pef E:163-286)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742617Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1742618Protein automated matches [226851] (30 species)
    not a true protein
  7. 1742674Species Geobacter metallireducens [TaxId:28232] [233234] (1 PDB entry)
  8. 1742679Domain d3pefe2: 3pef E:163-286 [239614]
    Other proteins in same PDB: d3pefa1, d3pefb1, d3pefc1, d3pefd1, d3pefe1, d3peff1, d3pefg1, d3pefh1
    automated match to d3pefa2
    complexed with edo, gol, nap, peg

Details for d3pefe2

PDB Entry: 3pef (more details), 2.07 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+
PDB Compounds: (E:) 6-phosphogluconate dehydrogenase, NAD-binding

SCOPe Domain Sequences for d3pefe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pefe2 a.100.1.0 (E:163-286) automated matches {Geobacter metallireducens [TaxId: 28232]}
dvgkgaemklvvnmvmggmmacfceglalgekaglatdaildvigagamanpmfalkggl
irdrnfapafplkhmqkdlrlavalgdrvgqplvasaaanelfkgaraagfgdedfsaif
ktye

SCOPe Domain Coordinates for d3pefe2:

Click to download the PDB-style file with coordinates for d3pefe2.
(The format of our PDB-style files is described here.)

Timeline for d3pefe2: