Class a: All alpha proteins [46456] (286 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (30 species) not a true protein |
Species Geobacter metallireducens [TaxId:28232] [233234] (1 PDB entry) |
Domain d3pefe2: 3pef E:163-286 [239614] Other proteins in same PDB: d3pefa1, d3pefb1, d3pefc1, d3pefd1, d3pefe1, d3peff1, d3pefg1, d3pefh1 automated match to d3pefa2 complexed with edo, gol, nap, peg |
PDB Entry: 3pef (more details), 2.07 Å
SCOPe Domain Sequences for d3pefe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pefe2 a.100.1.0 (E:163-286) automated matches {Geobacter metallireducens [TaxId: 28232]} dvgkgaemklvvnmvmggmmacfceglalgekaglatdaildvigagamanpmfalkggl irdrnfapafplkhmqkdlrlavalgdrvgqplvasaaanelfkgaraagfgdedfsaif ktye
Timeline for d3pefe2: