Lineage for d3dxjf2 (3dxj F:258-318)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309198Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2309301Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 2309302Protein automated matches [254475] (4 species)
    not a true protein
  7. 2309310Species Thermus thermophilus HB8 [TaxId:300852] [255804] (3 PDB entries)
  8. 2309319Domain d3dxjf2: 3dxj F:258-318 [239226]
    Other proteins in same PDB: d3dxjc_, d3dxjd_, d3dxje_, d3dxjf1, d3dxjm_, d3dxjn_, d3dxjo_, d3dxjp1
    automated match to d1smyf1
    protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn

Details for d3dxjf2

PDB Entry: 3dxj (more details), 3 Å

PDB Description: Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic myxopyronin
PDB Compounds: (F:) RNA polymerase pricipal sigma factor (RpoD); CHAIN F, P

SCOPe Domain Sequences for d3dxjf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxjf2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d3dxjf2:

Click to download the PDB-style file with coordinates for d3dxjf2.
(The format of our PDB-style files is described here.)

Timeline for d3dxjf2: