Lineage for d3dxjf1 (3dxj F:74-257)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348998Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2348999Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2349000Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2349044Protein automated matches [254474] (3 species)
    not a true protein
  7. 2349045Species Thermus thermophilus HB8 [TaxId:300852] [255803] (1 PDB entry)
  8. 2349046Domain d3dxjf1: 3dxj F:74-257 [239225]
    Other proteins in same PDB: d3dxjc_, d3dxjd_, d3dxje_, d3dxjf2, d3dxjf3, d3dxjm_, d3dxjn_, d3dxjo_, d3dxjp2, d3dxjp3
    automated match to d1smyf3
    protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn

Details for d3dxjf1

PDB Entry: 3dxj (more details), 3 Å

PDB Description: Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic myxopyronin
PDB Compounds: (F:) RNA polymerase pricipal sigma factor (RpoD); CHAIN F, P

SCOPe Domain Sequences for d3dxjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxjf1 a.177.1.1 (F:74-257) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d3dxjf1:

Click to download the PDB-style file with coordinates for d3dxjf1.
(The format of our PDB-style files is described here.)

Timeline for d3dxjf1: