Lineage for d3c75m_ (3c75 M:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034510Protein automated matches [190303] (3 species)
    not a true protein
  7. 3034548Species Paracoccus versutus [TaxId:34007] [255772] (1 PDB entry)
  8. 3034550Domain d3c75m_: 3c75 M: [239180]
    Other proteins in same PDB: d3c75a_, d3c75b_
    automated match to d4fa9e_
    complexed with cu

Details for d3c75m_

PDB Entry: 3c75 (more details), 2.5 Å

PDB Description: Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
PDB Compounds: (M:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3c75m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c75m_ g.21.1.1 (M:) automated matches {Paracoccus versutus [TaxId: 34007]}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3c75m_:

Click to download the PDB-style file with coordinates for d3c75m_.
(The format of our PDB-style files is described here.)

Timeline for d3c75m_: