| Class g: Small proteins [56992] (100 folds) |
| Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) ![]() |
| Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
| Protein automated matches [190303] (3 species) not a true protein |
| Species Paracoccus versutus [TaxId:34007] [255772] (1 PDB entry) |
| Domain d3c75m_: 3c75 M: [239180] Other proteins in same PDB: d3c75a_, d3c75b_ automated match to d4fa9e_ complexed with cu |
PDB Entry: 3c75 (more details), 2.5 Å
SCOPe Domain Sequences for d3c75m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c75m_ g.21.1.1 (M:) automated matches {Paracoccus versutus [TaxId: 34007]}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas
Timeline for d3c75m_: