Lineage for d3c75b_ (3c75 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770993Protein automated matches [190545] (9 species)
    not a true protein
  7. 2771013Species Paracoccus versutus [TaxId:34007] [225566] (1 PDB entry)
  8. 2771015Domain d3c75b_: 3c75 B: [208815]
    Other proteins in same PDB: d3c75l_, d3c75m_
    automated match to d1id2a_
    complexed with cu

Details for d3c75b_

PDB Entry: 3c75 (more details), 2.5 Å

PDB Description: Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
PDB Compounds: (B:) amicyanin

SCOPe Domain Sequences for d3c75b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c75b_ b.6.1.1 (B:) automated matches {Paracoccus versutus [TaxId: 34007]}
qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk
givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive

SCOPe Domain Coordinates for d3c75b_:

Click to download the PDB-style file with coordinates for d3c75b_.
(The format of our PDB-style files is described here.)

Timeline for d3c75b_: