Lineage for d1deva_ (1dev A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049541Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2049542Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2049543Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. 2049550Protein Smad2 MH2 domain [49883] (1 species)
  7. 2049551Species Human (Homo sapiens) [TaxId:9606] [49884] (3 PDB entries)
  8. 2049553Domain d1deva_: 1dev A: [23914]
    Other proteins in same PDB: d1devb_, d1devd_

Details for d1deva_

PDB Entry: 1dev (more details), 2.2 Å

PDB Description: crystal structure of smad2 mh2 domain bound to the smad-binding domain of sara
PDB Compounds: (A:) MAD (mothers against decapentaplegic, Drosophila) homolog 2

SCOPe Domain Sequences for d1deva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deva_ b.26.1.1 (A:) Smad2 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
lqpvtysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrn
atvemtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnl
kifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhl
ngplqwldkvltqm

SCOPe Domain Coordinates for d1deva_:

Click to download the PDB-style file with coordinates for d1deva_.
(The format of our PDB-style files is described here.)

Timeline for d1deva_: