SCOPe 2.06: Domain d1devb_: 1dev B:

Lineage for d1devb_ (1dev B:)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.64: Smad-binding domain of Sara [58717] (1 superfamily)

4. Superfamily j.64.1: Smad-binding domain of Sara [58718] (1 family)

5. Family j.64.1.1: Smad-binding domain of Sara [58719] (1 protein)

6. Protein Smad-binding domain of Sara [58720] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58721] (2 PDB entries)

8. Domain d1devb_: 1dev B: [46354]
   Other proteins in same PDB: d1deva_, d1devc_
   bound to the Smad2 MH2 domain

Details for d1devb_

PDB Entry: 1dev, 2.2 Å

PDB Description: crystal structure of smad2 mh2 domain bound to the smad-binding domain of sara

PDB Compounds: (B:) Smad anchor for receptor activation

SCOPe Domain Sequences for d1devb_:

Sequence; same for both SEQRES and ATOM records:

>d1devb_ j.64.1.1 (B:) Smad-binding domain of Sara {Human (Homo sapiens) [TaxId: 9606]}
sqspnpnnpaeycstipplqqaqasgalssppptvmvpvgv

Timeline for d1devb_:

• d1devb_ first appeared (with stable ids) in SCOP 1.55
  
• d1devb_ appears in SCOPe 2.05
  
• d1devb_ appears in SCOPe 2.07
  
• d1devb_ appears in the current release, SCOPe 2.08