![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins) automatically mapped to Pfam PF00941 |
![]() | Protein Xanthine oxidase, domain 3 (?) [56191] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56192] (10 PDB entries) Uniprot P80457 |
![]() | Domain d3ax7a5: 3ax7 A:224-414 [239112] Other proteins in same PDB: d3ax7a1, d3ax7a2, d3ax7a3, d3ax7a4, d3ax7a6, d3ax7b1, d3ax7b2, d3ax7b3, d3ax7b4, d3ax7b6 complexed with bct, ca, fad, fes, gol, sal, xax |
PDB Entry: 3ax7 (more details), 2.34 Å
SCOPe Domain Sequences for d3ax7a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ax7a5 d.145.1.3 (A:224-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]} pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei llsieipysre
Timeline for d3ax7a5: