![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Xanthine oxidase, N-terminal domain [54318] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries) Uniprot P80457 |
![]() | Domain d3ax7b1: 3ax7 B:2-92 [208402] Other proteins in same PDB: d3ax7a2, d3ax7a3, d3ax7a4, d3ax7a5, d3ax7a6, d3ax7b2, d3ax7b3, d3ax7b4, d3ax7b5, d3ax7b6 automated match to d1v97a2 complexed with bct, ca, fad, fes, gol, sal, xax |
PDB Entry: 3ax7 (more details), 2.34 Å
SCOPe Domain Sequences for d3ax7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ax7b1 d.15.4.2 (B:2-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl qdkiihfsanaclapictlhhvavttvegig
Timeline for d3ax7b1: