Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries) Uniprot P80457 |
Domain d3ax7b3: 3ax7 B:415-528 [208404] Other proteins in same PDB: d3ax7a1, d3ax7a2, d3ax7a4, d3ax7a5, d3ax7a6, d3ax7b1, d3ax7b2, d3ax7b4, d3ax7b5, d3ax7b6 automated match to d1v97a4 complexed with bct, ca, fad, fes, gol, sal, xax |
PDB Entry: 3ax7 (more details), 2.34 Å
SCOPe Domain Sequences for d3ax7b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ax7b3 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3ax7b3: