Lineage for d3a8jb2 (3a8j B:277-363)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792653Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) (S)
  5. 1792678Family b.44.2.0: automated matches [231768] (1 protein)
    not a true family
  6. 1792679Protein automated matches [231769] (1 species)
    not a true protein
  7. 1792680Species Escherichia coli K-12 [TaxId:83333] [231770] (3 PDB entries)
  8. 1792686Domain d3a8jb2: 3a8j B:277-363 [239089]
    Other proteins in same PDB: d3a8ja1, d3a8jb1, d3a8jc1, d3a8jd1, d3a8je_, d3a8jf_
    automated match to d3a8ia2

Details for d3a8jb2

PDB Entry: 3a8j (more details), 1.98 Å

PDB Description: Crystal Structure of ET-EHred complex
PDB Compounds: (B:) Aminomethyltransferase

SCOPe Domain Sequences for d3a8jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8jb2 b.44.2.0 (B:277-363) automated matches {Escherichia coli K-12 [TaxId: 83333]}
teklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegiget
aivqirnrempvkvtkpvfvrngkava

SCOPe Domain Coordinates for d3a8jb2:

Click to download the PDB-style file with coordinates for d3a8jb2.
(The format of our PDB-style files is described here.)

Timeline for d3a8jb2: