SCOPe 2.05: Domain d3a8jf_: 3a8j F:

Lineage for d3a8jf_ (3a8j F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Protein H of glycine cleavage system [51236] (4 species)

7. Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries)

8. Domain d3a8jf_: 3a8j F: [171874]
   Other proteins in same PDB: d3a8ja1, d3a8ja2, d3a8jb1, d3a8jb2, d3a8jc1, d3a8jc2, d3a8jd1, d3a8jd2
   automated match to d1onla_

Details for d3a8jf_

PDB Entry: 3a8j, 1.98 Å

PDB Description: Crystal Structure of ET-EHred complex

PDB Compounds: (F:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a8jf_:

Sequence; same for both SEQRES and ATOM records:

>d3a8jf_ b.84.1.1 (F:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
yeallede

Timeline for d3a8jf_:

• d3a8jf_ first appeared in SCOPe 2.01
  
• d3a8jf_ appears in SCOPe 2.04
  
• d3a8jf_ appears in SCOPe 2.06
  
• d3a8jf_ appears in the current release, SCOPe 2.08