| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.250: Folate-binding domain [103024] (1 superfamily) duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands |
Superfamily d.250.1: Folate-binding domain [103025] (2 families) ![]() some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase |
| Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins) |
| Protein automated matches [231765] (1 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [231766] (3 PDB entries) |
| Domain d3a8ja1: 3a8j A:1-276 [239086] Other proteins in same PDB: d3a8ja2, d3a8jb2, d3a8jc2, d3a8jd2, d3a8je_, d3a8jf_ automated match to d3a8ia1 |
PDB Entry: 3a8j (more details), 1.98 Å
SCOPe Domain Sequences for d3a8ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a8ja1 d.250.1.1 (A:1-276) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aqqtplyeqhtlcgarmvdfhgwmmplhygsqidehhavrtdagmfdvshmtivdlrgsr
treflryllandvakltksgkalysgmlnasggviddlivyyftedffrlvvnsatrekd
lswitqhaepfgieitvrddlsmiavqgpnaqakaatlfndaqrqavegmkpffgvqagd
lfiattgytgeagyeialpnekaadfwralveagvkpcglgardtlrleagmnlygqemd
etisplaanmgwtiawepadrdfigrealevqrehg
Timeline for d3a8ja1: