Class b: All beta proteins [48724] (178 folds) |
Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) has two smaller insertion domains |
Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins) automatically mapped to Pfam PF00314 |
Protein Zeamatin [49874] (1 species) antifungal protein |
Species Maize (Zea mays) [TaxId:4577] [49875] (1 PDB entry) |
Domain d1du5b_: 1du5 B: [23902] |
PDB Entry: 1du5 (more details), 2.5 Å
SCOPe Domain Sequences for d1du5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1du5b_ b.25.1.1 (B:) Zeamatin {Maize (Zea mays) [TaxId: 4577]} avftvvnqcpftvwaasvpvgggrqlnrgeswritapagttaariwartgckfdasgrgs crtgdcggvlqctgygrapntlaeyalkqfnnldffdislidgfnvpmsflpdggsgcsr gprcavdvnarcpaelrqdgvcnnacpvfkkdeyccvgsaandchptnysryfkgqcpda ysypkddatstftcpagtnykvvfcp
Timeline for d1du5b_: