Lineage for d1du5b_ (1du5 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2778003Protein Zeamatin [49874] (1 species)
    antifungal protein
  7. 2778004Species Maize (Zea mays) [TaxId:4577] [49875] (1 PDB entry)
  8. 2778006Domain d1du5b_: 1du5 B: [23902]

Details for d1du5b_

PDB Entry: 1du5 (more details), 2.5 Å

PDB Description: the crystal structure of zeamatin.
PDB Compounds: (B:) zeamatin

SCOPe Domain Sequences for d1du5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du5b_ b.25.1.1 (B:) Zeamatin {Maize (Zea mays) [TaxId: 4577]}
avftvvnqcpftvwaasvpvgggrqlnrgeswritapagttaariwartgckfdasgrgs
crtgdcggvlqctgygrapntlaeyalkqfnnldffdislidgfnvpmsflpdggsgcsr
gprcavdvnarcpaelrqdgvcnnacpvfkkdeyccvgsaandchptnysryfkgqcpda
ysypkddatstftcpagtnykvvfcp

SCOPe Domain Coordinates for d1du5b_:

Click to download the PDB-style file with coordinates for d1du5b_.
(The format of our PDB-style files is described here.)

Timeline for d1du5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1du5a_