SCOPe 2.08: Domain d1du5a_: 1du5 A:

Lineage for d1du5a_ (1du5 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein Zeamatin [49874] (1 species)
   antifungal protein

7. Species Maize (Zea mays) [TaxId:4577] [49875] (1 PDB entry)

8. Domain d1du5a_: 1du5 A: [23901]

Details for d1du5a_

PDB Entry: 1du5, 2.5 Å

PDB Description: the crystal structure of zeamatin.

PDB Compounds: (A:) zeamatin

SCOPe Domain Sequences for d1du5a_:

Sequence; same for both SEQRES and ATOM records:

>d1du5a_ b.25.1.1 (A:) Zeamatin {Maize (Zea mays) [TaxId: 4577]}
avftvvnqcpftvwaasvpvgggrqlnrgeswritapagttaariwartgckfdasgrgs
crtgdcggvlqctgygrapntlaeyalkqfnnldffdislidgfnvpmsflpdggsgcsr
gprcavdvnarcpaelrqdgvcnnacpvfkkdeyccvgsaandchptnysryfkgqcpda
ysypkddatstftcpagtnykvvfcp

Timeline for d1du5a_:

• d1du5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1du5a_ appears in SCOPe 2.07