SCOPe 2.08: Domain d2v7qb3: 2v7q B:380-510

Lineage for d2v7qb3 (2v7q B:380-510)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)

8. Domain d2v7qb3: 2v7q B:380-510 [238881]
   Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qb1, d2v7qb2, d2v7qc1, d2v7qc2, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_
   automated match to d1maba1
   complexed with adp, atp, mg, po4

Details for d2v7qb3

PDB Entry: 2v7q, 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.

PDB Compounds: (B:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2v7qb3:

Sequence, based on SEQRES records:

>d2v7qb3 a.69.1.0 (B:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records):

>d2v7qb3 a.69.1.0 (B:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya
gvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklkeivtnflag
fea

Timeline for d2v7qb3:

• d2v7qb3 first appeared in SCOPe 2.04
  
• d2v7qb3 appears in SCOPe 2.07