| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
| Protein automated matches [254528] (17 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries) |
| Domain d2v7qa3: 2v7q A:380-510 [238878] Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qb1, d2v7qb2, d2v7qc1, d2v7qc2, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_ automated match to d1maba1 complexed with adp, atp, mg, po4 |
PDB Entry: 2v7q (more details), 2.1 Å
SCOPe Domain Sequences for d2v7qa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7qa3 a.69.1.0 (A:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfea
Timeline for d2v7qa3: