Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries) |
Domain d2v7qb1: 2v7q B:24-94 [238879] Other proteins in same PDB: d2v7qa2, d2v7qa3, d2v7qb2, d2v7qb3, d2v7qc2, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_ automated match to d1maba2 complexed with adp, atp, mg, po4 |
PDB Entry: 2v7q (more details), 2.1 Å
SCOPe Domain Sequences for d2v7qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7qb1 b.49.1.0 (B:24-94) automated matches {Cow (Bos taurus) [TaxId: 9913]} dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik egdivkrtgai
Timeline for d2v7qb1: