Lineage for d2v7qa1 (2v7q A:24-94)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408357Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2408358Protein automated matches [254527] (17 species)
    not a true protein
  7. 2408393Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries)
  8. 2408394Domain d2v7qa1: 2v7q A:24-94 [238876]
    Other proteins in same PDB: d2v7qa2, d2v7qa3, d2v7qb2, d2v7qb3, d2v7qc2, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_
    automated match to d1maba2
    complexed with adp, atp, mg, po4

Details for d2v7qa1

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (A:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2v7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7qa1 b.49.1.0 (A:24-94) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d2v7qa1:

Click to download the PDB-style file with coordinates for d2v7qa1.
(The format of our PDB-style files is described here.)

Timeline for d2v7qa1: