SCOP 1.67: Domain d2tnfc_: 2tnf C:

Lineage for d2tnfc_ (2tnf C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (1 family)

5. Family b.22.1.1: TNF-like [49843] (11 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49850] (1 PDB entry)

8. Domain d2tnfc_: 2tnf C: [23882]
   complexed with ipa, trs

Details for d2tnfc_

PDB Entry: 2tnf, 1.4 Å

PDB Description: 1.4 a resolution structure of mouse tumor necrosis factor, towards modulation of its selectivity and trimerisation

SCOP Domain Sequences for d2tnfc_:

Sequence; same for both SEQRES and ATOM records:

>d2tnfc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Mouse (Mus musculus)}
sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
dqlsaevnlpkyldfaesgqvyfgvial

Timeline for d2tnfc_:

• d2tnfc_ first appeared (with stable ids) in SCOP 1.55
  
• d2tnfc_ appears in SCOP 1.65
  
• d2tnfc_ appears in SCOP 1.69
  
• d2tnfc_ appears in the current release, SCOPe 2.08