![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Tumor necrosis factor (TNF) [49848] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49850] (3 PDB entries) |
![]() | Domain d2tnfc_: 2tnf C: [23882] complexed with ipa, trs |
PDB Entry: 2tnf (more details), 1.4 Å
SCOPe Domain Sequences for d2tnfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tnfc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Mouse (Mus musculus) [TaxId: 10090]} sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg dqlsaevnlpkyldfaesgqvyfgvial
Timeline for d2tnfc_: