Lineage for d2tnfc_ (2tnf C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12261Fold b.22: TNF-like [49841] (1 superfamily)
  4. 12262Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 12263Family b.22.1.1: TNF-like [49843] (4 proteins)
  6. 12286Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 12308Species Mouse (Mus musculus) [TaxId:10090] [49850] (1 PDB entry)
  8. 12311Domain d2tnfc_: 2tnf C: [23882]

Details for d2tnfc_

PDB Entry: 2tnf (more details), 1.4 Å

PDB Description: 1.4 a resolution structure of mouse tumor necrosis factor, towards modulation of its selectivity and trimerisation
PDB Compounds: (C:)

SCOP Domain Sequences for d2tnfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tnfc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Mouse (Mus musculus)}
sdkpvahvvanhqveeqlewlsqranallangmdlkdnqlvvpadglylvysqvlfkgqg
cpdyvllthtvsrfaisyqekvnllsavkspcpkdtpegaelkpwyepiylggvfqlekg
dqlsaevnlpkyldfaesgqvyfgvial

SCOP Domain Coordinates for d2tnfc_:

Click to download the PDB-style file with coordinates for d2tnfc_.
(The format of our PDB-style files is described here.)

Timeline for d2tnfc_: