Lineage for d2ordb1 (2ord B:1-385)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505699Species Thermotoga maritima [TaxId:243274] [230690] (4 PDB entries)
  8. 2505702Domain d2ordb1: 2ord B:1-385 [238784]
    Other proteins in same PDB: d2orda2, d2ordb2
    automated match to d2orda_
    complexed with gol, plp

Details for d2ordb1

PDB Entry: 2ord (more details), 1.4 Å

PDB Description: crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
PDB Compounds: (B:) Acetylornithine aminotransferase

SCOPe Domain Sequences for d2ordb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ordb1 c.67.1.0 (B:1-385) automated matches {Thermotoga maritima [TaxId: 243274]}
mylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshprlveaikdqaekl
ihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarkygkkksekkyril
sahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkmsedvcavflepi
qgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqkygvvpdvlttak
glgggvpigavivneranvlepgdhgttfggnplacragvtvikeltkegfleeveekgn
ylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkllvvpagnntirf
lppltveygeidlavetlkkvlqgi

SCOPe Domain Coordinates for d2ordb1:

Click to download the PDB-style file with coordinates for d2ordb1.
(The format of our PDB-style files is described here.)

Timeline for d2ordb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ordb2