SCOP 1.63: Domain d2tunb_: 2tun B:

Lineage for d2tunb_ (2tun B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (1 family)

5. Family b.22.1.1: TNF-like [49843] (7 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries)

8. Domain d2tunb_: 2tun B: [23875]

Details for d2tunb_

PDB Entry: 2tun, 3.1 Å

PDB Description: conformational changes in the (ala-84-val) mutant of tumor necrosis factor

SCOP Domain Sequences for d2tunb_:

Sequence; same for both SEQRES and ATOM records:

>d2tunb_ b.22.1.1 (B:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
tpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkg
qgcpsthvllthtisrivvsyqtkvnllsaikspcqretpegaeakpwyepiylggvfql
ekgdrlsaeinrpdyllfaesgqvyfgiial

Timeline for d2tunb_:

• d2tunb_ first appeared (with stable ids) in SCOP 1.55
  
• d2tunb_ appears in SCOP 1.61
  
• d2tunb_ appears in SCOP 1.65
  
• d2tunb_ appears in the current release, SCOPe 2.08