Lineage for d2issc_ (2iss C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1567047Family c.1.2.6: PdxS-like [141755] (2 proteins)
    Pfam PF01680; SOR/SNZ
  6. 1567056Protein automated matches [193117] (4 species)
    not a true protein
  7. 1567080Species Thermotoga maritima [TaxId:2336] [255244] (1 PDB entry)
  8. 1567083Domain d2issc_: 2iss C: [238687]
    Other proteins in same PDB: d2issd_, d2isse_, d2issf_
    automated match to d2nv2i_
    complexed with 5rp, po4

Details for d2issc_

PDB Entry: 2iss (more details), 2.9 Å

PDB Description: Structure of the PLP synthase Holoenzyme from Thermotoga maritima
PDB Compounds: (C:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d2issc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2issc_ c.1.2.6 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
meikkgtwiikkgfaemfkggvimdvtsaeqakiaeeagavavmalervpadirkeggva
rmasiakireimeavsipvmakvrighiaeakileelgvdfidesevltpaddrfhinkh
efkvpfvcgardlgealrriaegaamirtkgeagtgnvveavkhmrrvmeqikqvtkmed
eelvaygkeigapvellrevkrlgrlpvvnfaaggvatpadaalmmmlgadgvfvgsgif
kskdprkmakamvlavtywdnprillkisedigepmrgld

SCOPe Domain Coordinates for d2issc_:

Click to download the PDB-style file with coordinates for d2issc_.
(The format of our PDB-style files is described here.)

Timeline for d2issc_: