Lineage for d2bxdb3 (2bxd B:5-196)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. Protein automated matches [254493] (6 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)
  8. Domain d2bxdb3: 2bxd B:5-196 [238627]
    automated match to d3jrya1
    complexed with rwf

Details for d2bxdb3

PDB Entry: 2bxd (more details), 3.05 Å

PDB Description: human serum albumin complexed with warfarin
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2bxdb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxdb3 a.126.1.0 (B:5-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

SCOPe Domain Coordinates for d2bxdb3 are not available.

Timeline for d2bxdb3:

Domains from same chain:
(mouse over for more information)
d2bxdb1, d2bxdb2
Domains from other chains:
(mouse over for more information)
d2bxda1, d2bxda2, d2bxda3