SCOPe 2.08: Domain d2bxda2: 2bxd A:389-582

Lineage for d2bxda2 (2bxd A:389-582)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)

8. Domain d2bxda2: 2bxd A:389-582 [129414]
   automated match to d4emxa3
   complexed with rwf

Details for d2bxda2

PDB Entry: 2bxd, 3.05 Å

PDB Description: human serum albumin complexed with warfarin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2bxda2:

Sequence; same for both SEQRES and ATOM records:

>d2bxda2 a.126.1.0 (A:389-582) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d2bxda2:

• d2bxda2 first appeared in SCOP 1.73
  
• d2bxda2 appears in SCOPe 2.07