Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) |
Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins) |
Protein Thymidine phosphorylase [54682] (2 species) |
Species Escherichia coli [TaxId:562] [54683] (7 PDB entries) |
Domain d4lhma3: 4lhm A:336-440 [238428] Other proteins in same PDB: d4lhma1, d4lhma2 automated match to d2tpta3 complexed with azz, gol, so4 |
PDB Entry: 4lhm (more details), 1.52 Å
SCOPe Domain Sequences for d4lhma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lhma3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg qrplavihakdennwqeaakavkaaikladkapestptvyrrise
Timeline for d4lhma3: