PDB entry 4lhm

View 4lhm on RCSB PDB site
Description: Thymidine phosphorylase from E.coli with 3'-azido-3'-deoxythymidine
Class: transferase
Keywords: transferase
Deposited on 2013-07-01, released 2014-04-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.155
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Gene: deoA, tpp, ttg, b4382, JW4345
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07650 (1-439)
      • expression tag (0)
    Domains in SCOPe 2.05: d4lhma1, d4lhma2, d4lhma3
  • Heterogens: SO4, GOL, AZZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lhmA (A:)
    lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglght
    ggtldklesipgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsi
    plitasilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearakl
    qavldngkaaevfgrmvaaqkgptdfvenyakylptamltkavyadtegfvsemdtralg
    mavvamgggrrqasdtidysvgftdmarlgdqvdgqrplavihakdennwqeaakavkaa
    ikladkapestptvyrrise