SCOPe 2.06: Domain d4lhma3: 4lhm A:336-440

Lineage for d4lhma3 (4lhm A:336-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families)

5. Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins)

6. Protein Thymidine phosphorylase [54682] (2 species)

7. Species Escherichia coli [TaxId:562] [54683] (7 PDB entries)

8. Domain d4lhma3: 4lhm A:336-440 [238428]
   Other proteins in same PDB: d4lhma1, d4lhma2, d4lhma4
   automated match to d2tpta3
   complexed with azz, gol, so4

Details for d4lhma3

PDB Entry: 4lhm, 1.52 Å

PDB Description: Thymidine phosphorylase from E.coli with 3'-azido-3'-deoxythymidine

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4lhma3:

Sequence; same for both SEQRES and ATOM records:

>d4lhma3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
tamltkavyadtegfvsemdtralgmavvamgggrrqasdtidysvgftdmarlgdqvdg
qrplavihakdennwqeaakavkaaikladkapestptvyrrise

Timeline for d4lhma3:

• d4lhma3 first appeared in SCOPe 2.03
  
• d4lhma3 appears in SCOPe 2.05
  
• d4lhma3 appears in SCOPe 2.07
  
• d4lhma3 appears in the current release, SCOPe 2.08