![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
![]() | Domain d4o4jb2: 4o4j B:246-438 [238047] Other proteins in same PDB: d4o4ja1, d4o4jb1, d4o4jc1, d4o4jd1, d4o4je_, d4o4jf1, d4o4jf2 automated match to d4i4td2 complexed with acp, ca, gdp, gol, gtp, mg, pou |
PDB Entry: 4o4j (more details), 2.2 Å
SCOPe Domain Sequences for d4o4jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4jb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
Timeline for d4o4jb2: