Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d4o4jf2: 4o4j F:77-378 [344001] Other proteins in same PDB: d4o4ja1, d4o4ja2, d4o4jb1, d4o4jb2, d4o4jc1, d4o4jc2, d4o4jd1, d4o4jd2, d4o4je_, d4o4jf1 complexed with acp, ca, gdp, gol, gtp, mg, pou fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 4o4j (more details), 2.2 Å
SCOPe Domain Sequences for d4o4jf2:
Sequence, based on SEQRES records: (download)
>d4o4jf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d4o4jf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesqvhviqkylekplllepghrkfdirswvlvdhlyniyly regvlrtssepynschltnhcigryeegnemffeefnqylmdalelqikhiirsclmcie paistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvf plasifikl
Timeline for d4o4jf2: