Lineage for d4o4jf2 (4o4j F:77-378)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978888Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2978889Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2978890Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries)
  8. 2978938Domain d4o4jf2: 4o4j F:77-378 [344001]
    Other proteins in same PDB: d4o4ja1, d4o4ja2, d4o4jb1, d4o4jb2, d4o4jc1, d4o4jc2, d4o4jd1, d4o4jd2, d4o4je_, d4o4jf1
    complexed with acp, ca, gdp, gol, gtp, mg, pou
    fragment; missing more than one-third of the common structure and/or sequence

Details for d4o4jf2

PDB Entry: 4o4j (more details), 2.2 Å

PDB Description: Tubulin-Peloruside A complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4o4jf2:

Sequence, based on SEQRES records: (download)

>d4o4jf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d4o4jf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesqvhviqkylekplllepghrkfdirswvlvdhlyniyly
regvlrtssepynschltnhcigryeegnemffeefnqylmdalelqikhiirsclmcie
paistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvf
plasifikl

SCOPe Domain Coordinates for d4o4jf2:

Click to download the PDB-style file with coordinates for d4o4jf2.
(The format of our PDB-style files is described here.)

Timeline for d4o4jf2: