Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (19 species) not a true protein |
Species Coxsackievirus a16 [TaxId:231417] [238004] (1 PDB entry) |
Domain d4mg3b_: 4mg3 B: [238006] automated match to d4fvba_ complexed with 1pe, trs, zn |
PDB Entry: 4mg3 (more details), 1.8 Å
SCOPe Domain Sequences for d4mg3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mg3b_ b.47.1.0 (B:) automated matches {Coxsackievirus a16 [TaxId: 231417]} gkfgqqsgaiyvgnyrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcncqt gvyycsskrkhypvsftkpslifveaseyyparyqshlmlavghsepgdcggilrcqhgv vgivstggnglvgfadvrdllwlde
Timeline for d4mg3b_: