Lineage for d4mg3b_ (4mg3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798206Species Coxsackievirus a16 [TaxId:231417] [238004] (1 PDB entry)
  8. 2798208Domain d4mg3b_: 4mg3 B: [238006]
    automated match to d4fvba_
    complexed with 1pe, trs, zn

Details for d4mg3b_

PDB Entry: 4mg3 (more details), 1.8 Å

PDB Description: crystal structural analysis of 2a protease from coxsackievirus a16
PDB Compounds: (B:) Protease 2A

SCOPe Domain Sequences for d4mg3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mg3b_ b.47.1.0 (B:) automated matches {Coxsackievirus a16 [TaxId: 231417]}
gkfgqqsgaiyvgnyrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcncqt
gvyycsskrkhypvsftkpslifveaseyyparyqshlmlavghsepgdcggilrcqhgv
vgivstggnglvgfadvrdllwlde

SCOPe Domain Coordinates for d4mg3b_:

Click to download the PDB-style file with coordinates for d4mg3b_.
(The format of our PDB-style files is described here.)

Timeline for d4mg3b_: