| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
| Family b.1.13.0: automated matches [191383] (1 protein) not a true family |
| Protein automated matches [190481] (2 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:2234] [237922] (2 PDB entries) |
| Domain d4bffb_: 4bff B: [237926] automated match to d2hvba_ complexed with fe2 |
PDB Entry: 4bff (more details), 2 Å
SCOPe Domain Sequences for d4bffb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bffb_ b.1.13.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkekhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsl
Timeline for d4bffb_: