| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
| Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
| Protein automated matches [190694] (3 species) not a true protein |
| Species Pyrococcus horikoshii OT3 [TaxId:70601] [187828] (1 PDB entry) |
| Domain d2hvba_: 2hvb A: [165302] automated match to d1do6a_ complexed with fe |
PDB Entry: 2hvb (more details), 2.5 Å
SCOPe Domain Sequences for d2hvba_:
Sequence, based on SEQRES records: (download)
>d2hvba_ b.1.13.1 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mlketirsgdwkgekhvpvieyeregdlvkvevsvgkeiphpntpehhiawielyfhpeg
gqfpilvgrveftnhsdpltepravfffktskkgklyalsycnihglwenevqle
>d2hvba_ b.1.13.1 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mlketirsgdwekhvpvieyeregdlvkvevsvgkeiphpntpehhiawielyfhpeggq
fpilvgrveftnhsdpltepravfffktskkgklyalsycnihglwenevqle
Timeline for d2hvba_: