SCOPe 2.08: Domain d2btvi2: 2btv I:121-254

Lineage for d2btvi2 (2btv I:121-254)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
   this domain is inserted into a multihelical domain

6. Protein BTV vp7, central (top) domain [49820] (1 species)

7. Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)

8. Domain d2btvi2: 2btv I:121-254 [23791]
   Other proteins in same PDB: d2btva_, d2btvb_, d2btvc1, d2btvd1, d2btve1, d2btvf1, d2btvg1, d2btvh1, d2btvi1, d2btvj1, d2btvp1, d2btvq1, d2btvr1, d2btvs1, d2btvt1

Details for d2btvi2

PDB Entry: 2btv, 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core

PDB Compounds: (I:) protein (vp7 core protein)

SCOPe Domain Sequences for d2btvi2:

Sequence; same for both SEQRES and ATOM records:

>d2btvi2 b.19.1.1 (I:121-254) BTV vp7, central (top) domain {Bluetongue virus [TaxId: 40051]}
parqpygffleteetfqpgrwfmraaqaatavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvrnptqqn
amvqiqvvfyismd

Timeline for d2btvi2:

• d2btvi2 first appeared (with stable ids) in SCOP 1.55
  
• d2btvi2 appears in SCOPe 2.07