SCOPe 2.08: Domain d2btvt1: 2btv T:1-120,T:255-349

Lineage for d2btvt1 (2btv T:1-120,T:255-349)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
   multihelical; three-helical bundle in the core is surrounded by non-conserved helices

4. Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families)
   this domain is interrupted by a jelly-roll beta-sandwich domain

5. Family a.115.1.1: Orbivirus capsid [48346] (1 protein)

6. Protein BTV vp7 [48347] (1 species)

7. Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)

8. Domain d2btvt1: 2btv T:1-120,T:255-349 [19097]
   Other proteins in same PDB: d2btva_, d2btvb_, d2btvc2, d2btvd2, d2btve2, d2btvf2, d2btvg2, d2btvh2, d2btvi2, d2btvj2, d2btvp2, d2btvq2, d2btvr2, d2btvs2, d2btvt2

Details for d2btvt1

PDB Entry: 2btv, 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core

PDB Compounds: (T:) protein (vp7 core protein)

SCOPe Domain Sequences for d2btvt1:

Sequence; same for both SEQRES and ATOM records:

>d2btvt1 a.115.1.1 (T:1-120,T:255-349) BTV vp7 {Bluetongue virus [TaxId: 40051]}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtairnrttlpnmlppifppndrdsiltllll
stladvytvlrpefamhgvnpmpgpltaaiaraayv

Timeline for d2btvt1:

• d2btvt1 first appeared (with stable ids) in SCOP 1.55
  
• d2btvt1 appears in SCOPe 2.07