Lineage for d2btvi1 (2btv I:1-120,I:255-349)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725196Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
    multihelical; three-helical bundle in the core is surrounded by non-conserved helices
  4. 2725197Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) (S)
    this domain is interrupted by a jelly-roll beta-sandwich domain
  5. 2725198Family a.115.1.1: Orbivirus capsid [48346] (1 protein)
  6. 2725199Protein BTV vp7 [48347] (1 species)
  7. 2725200Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)
  8. 2725213Domain d2btvi1: 2btv I:1-120,I:255-349 [19095]
    Other proteins in same PDB: d2btva_, d2btvb_, d2btvc2, d2btvd2, d2btve2, d2btvf2, d2btvg2, d2btvh2, d2btvi2, d2btvj2, d2btvp2, d2btvq2, d2btvr2, d2btvs2, d2btvt2

Details for d2btvi1

PDB Entry: 2btv (more details), 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core
PDB Compounds: (I:) protein (vp7 core protein)

SCOPe Domain Sequences for d2btvi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btvi1 a.115.1.1 (I:1-120,I:255-349) BTV vp7 {Bluetongue virus [TaxId: 40051]}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtairnrttlpnmlppifppndrdsiltllll
stladvytvlrpefamhgvnpmpgpltaaiaraayv

SCOPe Domain Coordinates for d2btvi1:

Click to download the PDB-style file with coordinates for d2btvi1.
(The format of our PDB-style files is described here.)

Timeline for d2btvi1: