SCOPe 2.06: Domain d4nljb_: 4nlj B:

Lineage for d4nljb_ (4nlj B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [237679] (4 PDB entries)

8. Domain d4nljb_: 4nlj B: [237846]
   automated match to d4nlia_
   complexed with so4

Details for d4nljb_

PDB Entry: 4nlj, 1.4 Å

PDB Description: Crystal structure of sheep beta-lactoglobulin (space group P1)

PDB Compounds: (B:) Beta-lactoglobulin-1/B

SCOPe Domain Sequences for d4nljb_:

Sequence; same for both SEQRES and ATOM records:

>d4nljb_ b.60.1.1 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqkweng
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclvr
tpevdnealekfdkalkalpmhirlafnptqlegqchv

Timeline for d4nljb_:

• d4nljb_ first appeared in SCOPe 2.03
  
• d4nljb_ appears in SCOPe 2.05
  
• d4nljb_ appears in SCOPe 2.07
  
• d4nljb_ appears in the current release, SCOPe 2.08