Lineage for d1bvp12 (1bvp 1:121-254)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385150Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
    this domain is inserted into a multihelical domain
  6. 2385151Protein BTV vp7, central (top) domain [49820] (1 species)
  7. 2385152Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)
  8. 2385153Domain d1bvp12: 1bvp 1:121-254 [23775]
    Other proteins in same PDB: d1bvp11, d1bvp21, d1bvp31, d1bvp41, d1bvp51, d1bvp61

Details for d1bvp12

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7
PDB Compounds: (1:) bluetongue virus coat protein vp7

SCOPe Domain Sequences for d1bvp12:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp12 b.19.1.1 (1:121-254) BTV vp7, central (top) domain {Bluetongue virus [TaxId: 40051]}
parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
amvqiqvvfyismd

SCOPe Domain Coordinates for d1bvp12:

Click to download the PDB-style file with coordinates for d1bvp12.
(The format of our PDB-style files is described here.)

Timeline for d1bvp12: