Lineage for d1bvp21 (1bvp 2:1-120,2:255-349)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
multihelical; three-helical bundle in the core is surrounded by non-conserved helicesSuperfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) 
this domain is interrupted by a jelly-roll beta-sandwich domain
Family a.115.1.1: Orbivirus capsid [48346] (1 protein) Protein BTV vp7 [48347] (1 species) Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries) 
Domain d1bvp21: 1bvp 2:1-120,2:255-349 [19080]
Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62
Details for d1bvp21
PDB Entry: 1bvp (more details), 2.6 Å
PDB Description: the crystal structure of bluetongue virus vp7
PDB Compounds: (2:) bluetongue virus coat protein vp7SCOPe Domain Sequences for d1bvp21:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvp21 a.115.1.1 (2:1-120,2:255-349) BTV vp7 {Bluetongue virus [TaxId: 40051]}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv
SCOPe Domain Coordinates for d1bvp21:
Click to download the PDB-style file with coordinates for d1bvp21.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bvp21:
View in 3D
