SCOPe 2.08: Domain d3wdpq1: 3wdp Q:2-472

Lineage for d3wdpq1 (3wdp Q:2-472)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)

6. Protein automated matches [190245] (12 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [189762] (2 PDB entries)

8. Domain d3wdpq1: 3wdp Q:2-472 [237741]
   Other proteins in same PDB: d3wdpp2, d3wdpq2, d3wdpr2, d3wdps2
   automated match to d1uwsa_
   complexed with gol, po4; mutant

Details for d3wdpq1

PDB Entry: 3wdp, 1.7 Å

PDB Description: structural analysis of a beta-glucosidase mutant derived from a hyperthermophilic tetrameric structure

PDB Compounds: (Q:) Beta-glucosidase

SCOPe Domain Sequences for d3wdpq1:

Sequence; same for both SEQRES and ATOM records:

>d3wdpq1 c.1.8.4 (Q:2-472) automated matches {Pyrococcus furiosus [TaxId: 2261]}
kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldektv
vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnli
qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln
nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg
frmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk

Timeline for d3wdpq1:

• d3wdpq1 first appeared in SCOPe 2.03, called d3wdpq_
  
• d3wdpq1 appears in SCOPe 2.07