SCOPe 2.07: Domain d4ms6a2: 4ms6 A:209-460

Lineage for d4ms6a2 (4ms6 A:209-460)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
   adopts thermolysin-like fold

6. Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64340] (57 PDB entries)
   Uniprot P09960

8. Domain d4ms6a2: 4ms6 A:209-460 [237659]
   Other proteins in same PDB: d4ms6a1, d4ms6a3
   automated match to d2vj8a3
   complexed with 28t, acy, yb, zn

Details for d4ms6a2

PDB Entry: 4ms6, 1.72 Å

PDB Description: Human Leukotriene A4 Hydrolase in complex with Pro-Gly-Pro analogue

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d4ms6a2:

Sequence; same for both SEQRES and ATOM records:

>d4ms6a2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

Timeline for d4ms6a2:

• d4ms6a2 first appeared in SCOPe 2.03
  
• d4ms6a2 appears in SCOPe 2.06
  
• d4ms6a2 appears in the current release, SCOPe 2.08