SCOPe 2.07: Domain d3zn2b_: 3zn2 B:

Lineage for d3zn2b_ (3zn2 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:358] [193697] (5 PDB entries)

8. Domain d3zn2b_: 3zn2 B: [237530]
   automated match to d3osua_
   complexed with act, k, na, pg5

Details for d3zn2b_

PDB Entry: 3zn2, 1.8 Å

PDB Description: protein engineering of halohydrin dehalogenase

PDB Compounds: (B:) halohydrin dehalogenase

SCOPe Domain Sequences for d3zn2b_:

Sequence; same for both SEQRES and ATOM records:

>d3zn2b_ c.2.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsaapfgpwkelstytsaragastlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierfpgmp

Timeline for d3zn2b_:

• d3zn2b_ first appeared in SCOPe 2.03
  
• d3zn2b_ appears in SCOPe 2.06
  
• d3zn2b_ appears in the current release, SCOPe 2.08