Lineage for d3zn2b_ (3zn2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845888Species Agrobacterium tumefaciens [TaxId:358] [193697] (5 PDB entries)
  8. 2845903Domain d3zn2b_: 3zn2 B: [237530]
    automated match to d3osua_
    complexed with act, k, na, pg5

Details for d3zn2b_

PDB Entry: 3zn2 (more details), 1.8 Å

PDB Description: protein engineering of halohydrin dehalogenase
PDB Compounds: (B:) halohydrin dehalogenase

SCOPe Domain Sequences for d3zn2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zn2b_ c.2.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsaapfgpwkelstytsaragastlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierfpgmp

SCOPe Domain Coordinates for d3zn2b_:

Click to download the PDB-style file with coordinates for d3zn2b_.
(The format of our PDB-style files is described here.)

Timeline for d3zn2b_: