Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:358] [193697] (5 PDB entries) |
Domain d3zn2b_: 3zn2 B: [237530] automated match to d3osua_ complexed with act, k, na, pg5 |
PDB Entry: 3zn2 (more details), 1.8 Å
SCOPe Domain Sequences for d3zn2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zn2b_ c.2.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 358]} staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk rksghiifitsaapfgpwkelstytsaragastlanalskelgeynipvfaigpnylhse dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag gfpmierfpgmp
Timeline for d3zn2b_: