Lineage for d3w7pa_ (3w7p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2827891Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2828001Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries)
  8. 2828064Domain d3w7pa_: 3w7p A: [237508]
    automated match to d3w1aa_
    complexed with fmn, gol, nco, w7p

    has additional subdomain(s) that are not in the common domain
    has additional insertions and/or extensions that are not grouped together

Details for d3w7pa_

PDB Entry: 3w7p (more details), 1.7 Å

PDB Description: structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-4-031
PDB Compounds: (A:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w7pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w7pa_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

SCOPe Domain Coordinates for d3w7pa_:

Click to download the PDB-style file with coordinates for d3w7pa_.
(The format of our PDB-style files is described here.)

Timeline for d3w7pa_: